PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OGLUM05G19970.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family TALE
Protein Properties Length: 578aa    MW: 61986.2 Da    PI: 8.2236
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OGLUM05G19970.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox32.21.8e-103563931954
                      HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
         Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                      Fe   ++yp+ ++++ LAk++gLt +qV++WF N R +
  OGLUM05G19970.1 356 FEHflHPYPTDSDKQMLAKQTGLTRNQVSNWFINARVR 393
                      554459******************************88 PP

2BELL91.77.2e-30223292372
             BELL   3 qelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                      +e q +k++L+sl+e V+krY+qy++qlq+v+ssFe+vagl +a+p++s+Al+++S+hF+ Lk  i +q+
  OGLUM05G19970.1 223 AEQQWRKTRLISLMEDVCKRYRQYYQQLQAVVSSFETVAGLSNAAPFASMALRTMSKHFKYLKGIILNQL 292
                      58899*************************************************************9996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005746.3E-34151290IPR006563POX domain
PfamPF075264.8E-36156288IPR006563POX domain
PROSITE profilePS5007112.455334397IPR001356Homeobox domain
SMARTSM003891.4E-11337401IPR001356Homeobox domain
CDDcd000864.37E-14337398No hitNo description
SuperFamilySSF466894.28E-17339404IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.4E-29340401IPR009057Homeodomain-like
PfamPF059205.1E-19354393IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010076Biological Processmaintenance of floral meristem identity
GO:0010077Biological Processmaintenance of inflorescence meristem identity
GO:0010089Biological Processxylem development
GO:0010154Biological Processfruit development
GO:0010223Biological Processsecondary shoot formation
GO:0010228Biological Processvegetative to reproductive phase transition of meristem
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048457Biological Processfloral whorl morphogenesis
GO:0048645Biological Processorgan formation
GO:0080006Biological Processinternode patterning
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 578 aa     Download sequence    Send to blast
MSSAAGGGGG YGGGGGEHQH QQQQHHLLLG QAAGQLYHVP QHSRREKLRF PPDHPAESPP  60
PPPPGSWPLP PAFYSYASSS SSYSPHSPTL AHAQLVAHGM PPGAATSGGA QIPSQNFALS  120
LSSASSNPPP TPRRQFGGGG GGAAGPYGPF TGYAAVLGRS RFLGPAQKLL EEICDVGGRP  180
AQLDRGSDEG LLDVDAMDAA GSVDHEMDGS DRAVADAVTV SGAEQQWRKT RLISLMEDVC  240
KRYRQYYQQL QAVVSSFETV AGLSNAAPFA SMALRTMSKH FKYLKGIILN QLRNTGKGAT  300
KDGLGKEDTA NFGLMGGGAG LLRGNNVNSF SQPHNIWRPQ RGLPERAVSV LRAWLFEHFL  360
HPYPTDSDKQ MLAKQTGLTR NQVSNWFINA RVRLWKPMVE EIHNLEMRQL QKNPSLDKNQ  420
LSMQHTQHSS ESSGKPCDPS NSLQGQSSSM TRNHSISASR HIEDGLSQMP HDISGQVSFA  480
YNGLAAHHSI AMAHHHQPDL IGTGGAANAG GVSLTLGLHQ NNNRAYIAEP LPAALPLNLA  540
HRFGLEDVSD AYVMSSFGGQ DRHFTKEIGG HLLHDFVG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4xrs_B2e-17343400158Homeobox protein Meis1
4xrs_A2e-17343400158Homeobox protein Meis1
5bng_A2e-17343401159Homeobox protein Meis2
5bng_B2e-17343401159Homeobox protein Meis2
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1009160.0AK100916.1 Oryza sativa Japonica Group cDNA clone:J023133E06, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015637721.10.0PREDICTED: BEL1-like homeodomain protein 9
TrEMBLA0A0E0A0490.0A0A0E0A049_9ORYZ; Uncharacterized protein
STRINGORGLA05G0163600.10.0(Oryza glaberrima)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP25283881
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02030.19e-68TALE family protein